PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g37147.2.p
Common NameBRADI_4g37147, LOC100825769
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Nin-like
Protein Properties Length: 904aa    MW: 99553.9 Da    PI: 7.4515
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g37147.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.75.4e-29587637252
            RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       ek++sl++l++yF++++kdAAk+Lgvc+T+LKriCRq+GI+RWP+Rkik++
  Bradi4g37147.2.p 587 EKTVSLQVLRQYFAGSLKDAAKNLGVCPTTLKRICRQHGINRWPSRKIKKV 637
                       799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.484576657IPR003035RWP-RK domain
PfamPF020421.8E-25589637IPR003035RWP-RK domain
SuperFamilySSF542773.6E-20795891No hitNo description
Gene3DG3DSA:3.10.20.2402.6E-23804886No hitNo description
SMARTSM006667.0E-18805888IPR000270PB1 domain
PROSITE profilePS5174520.199805888IPR000270PB1 domain
PfamPF005641.5E-14806886IPR000270PB1 domain
CDDcd064072.87E-41806886No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 904 aa     Download sequence    Send to blast
MMCSLLLPAP FNPNTSTSDT KIFFPRLPPS NTSCFTQDVQ PTMLLDSQQE RRNSEGSFTY  60
MEEGDAHPSI SVARTASSEG AAVDFDLLEQ LLSGDNAWLE VATNASRSPN FFASPCTFLS  120
DATTTTTTPA SANNNLWIQS SSTFRQRLDQ ALAYIEETQR DTDVLVQLWM PVKSNDGQLV  180
LTTSGQPFTL DKSSESLKRF RDVSTHYQFS ADVASESSPV GLPGRVFIGK LPEWSPDVRY  240
FTSYEYPRVN HAQDLDVHGT MGLPVFEKGN YSCLGVMELI MTRQKLNFTS EINNICSALQ  300
AVNLRSTEVS SIPRTKFNSA SYKDALPEIL EVLRAACITH KLPLAQTWVT CDQQGKRGSR  360
HSDENYRYCI STIDAACYVN DPCMQNFHYS CSEHHLLRGQ GVAGKAFTTN QPCFLPDIGS  420
STKLEYPLSH HAKIFNLKGA VAIRLRCTRT GTADFVLEFF LPTDCEALEE QKAVLDSLSG  480
TMRSVCQTLR VVTDKEMEDE AMLEMNELNS FGPKGKNKVK EFSFGGKATE HREEASWTSL  540
AGTSQKESDL AELSIHGMFS PGGQGSSLAG VQTTAQGSKG KRRTKTEKTV SLQVLRQYFA  600
GSLKDAAKNL GVCPTTLKRI CRQHGINRWP SRKIKKVDHS LRKLQQIIDS VHGGETAFQL  660
NNLYKDLTNT SVSSDNNLSG SITVPLTKQS NLTEFEKHRR HRLSNNAPST SHSHSSCSQS  720
SDSSPSCSGG ATKDSPPAGV DLMKSGSHVR HNPIQTLQAE NALINGHISV QEARGDLLHN  780
VNQKAIGGQH SSRSPSPPKQ NSDIGMRVKA TFGSEKVRFR LKPESGFQEL KQEMARRLSI  840
VDTSSLIVKY LDDDSEWVLM TCDADLQECL HVYKLANIQT VKISIHLAAN PETKVTVGHT  900
GLS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3586000.0AK358600.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1079K24.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010238468.10.0PREDICTED: protein NLP1 isoform X1
TrEMBLA0A0Q3EV320.0A0A0Q3EV32_BRADI; Uncharacterized protein
STRINGBRADI4G37147.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP55543852
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.10.0Nin-like family protein